Don't Kill Snails with Salt ... Creme Eggs & Toasted Teacakes ... Biscuits & Bench Stories, Life, the Universe, & Everything! Showing 51-100 of 9,236

[P]

Grach, did my afternoon-evening trudging yesterday and had one visit that makes it all worthwhile, better than all the nasty visits.

An elderly lady answered her door and I explained who I was/what the call was (always disconcerting for the elderly when faced with a confusing, 'official' visit). She had a soft Irish accent and when I asked her to sign her form I noticed her slow attempt at her signature was identical to my own mother's (it's almost as if all Irish children of a certain generation were taught to write that way). I told her - "Your writing is just like my mother's, she was Irish as well." The lady came alive, and wanted to know where she was from and told me where she was from and that she came over to England when she was 17, married a 'bad' man - the wrong one, and was sad to hear my mother had since died. She asked me in for a cup of tea! I told her I would love to, but I'd then be crossing my legs as I wlk the street. Unexpectedly, she reached up and stroked my face and said "You're a lovely man." Then she closed the door. It was a real 'Ahhhh' moment.

It also reaffirms your belief that there are nice people out there after getting short shrift and insults from others.

Wonder what today has in store?

[suzysunshine7]

P wrote: "Have you chosen to decorate your new shell, SS7?"

Oooh? - I hadn't thought about that? ;oO

Okay, well I am most definitely an Autumn kind of Girl so my Snail Shell would just have to be a rich and riotous mixture of intense Autumn leaf colours - glorious golds, fiery flames of red, outrageous oranges, and luscious lime greens ... which should hopefully also provide me with excellent camouflage from the keen eyes of very hungry Birds at this time of year as well ;o>

[P]

No 1 son visited the Chrysler Building yesterday and took panoramic piks from the top. They have forwarded some lovely ones.
Today they are headed to Ellis Island and S of L.
Weather and temps not too dissimilar to here.

, ,
\\@ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~

[suzysunshine7]

I've just realised that I must be a Rainbow Snail ;o> ...

[P]

suzysunshine7 wrote: "P wrote: "Have you chosen to decorate your new shell, SS7?"

Oooh? - I hadn't thought about that? ;oO

Okay, well I am most definitely an Autumn kind of Girl so my Snail Shell would just have to be..."

And there was me thinking it would have been in shades of pink and lilac gel nail polish! Instead you are practical as well as environmental! ;0>

[suzysunshine7]

P wrote: "An elderly lady answered her door and I explained who I was/wha..."

That reminds me of my most abiding memories of my very early childhood living with my darling Nan in Ireland - you were almost dragged over the Doorstep and forcibly fed whether you were hungry or not and until you almost felt like you might burst! The people I grew up with had nothing in the way of wealth or possessions but there was never any shortage of love to go round ... Happy Days ;o>

[suzysunshine7]

P wrote: "And there was me thinking it would have been in shades of pink and lilac gel nail polish! Instead you are practical as well as environmental! ;0> "

PINK ? ! ! ... ARRRGGGHHH ! ! ! ... NOOOOOOO ! ! ! ;oO

I can't stand Pink - I am most definitely NOT a girly kind of a Girl ;o>

[P]

I'll have to get you to explain the process for posting piks, Suzy

Is it just the address you use? Ok if sourcing from say Google piks, but not if posting up one of your own. Or, do you need to upload those to a pik host site first?

[P]

https://www.google.co.uk/imgres?imgur...

A sad snail? (That didn't work)

[P]

https://i.pinimg.com/736x/ea/97/2a/ea...

A sad snail? (well that link now works, but it needs to appear directly in the thread post!)

[suzysunshine7]

Okay well I'll try but it isn't very easy to explain on here because the System thinks you are trying to do an invalid link and so it blocks a simple explanation from being posted.

First you find your picture and Copy it's link info - then you come back on here and you need to put this at the start ...

<

... and leaving no space then put ...

img

... and then a space and then put this next to it ...

src="

... and then your link with no space between the " and the link - and then at the other end of the link you again leave no space and just add ...

">

I hope that makes some sense? - LOL! ;o>

(Edited because it blocked me twice and blanked the symbols out and so I had to break the sequence down further before it would let me post it up on here. I've had to post it in separate bits going downwards whereas you will need to put it all together and post it as a line going across the page instead)

[suzysunshine7]

P wrote: "https://i.pinimg.com/736x/ea/97/2a/ea...

A sad snail? (well that link now works, but it needs to appear directly in the thread post!)"

<
img

src="
https://i.pinimg.com/736x/ea/97/2a/ea...
"
>

Only you need to put this across the page instead of downwards and with the only space being between the img and the src="

[P]

A sad snail

[Lez]

P wrote: “Guess what will be telling is if their actual customer base has reduced as a result of their decision to close the Fora/Forums. I suppose that nigh on all, like your..."

I’ve only visited ‘zon twice - just to check titles for ‘3 Songs.....’ , not bought anything and probably won’t.
I suspect our custom was just a drop in the ocean and won’t be noticed.
The American Classical forum was probably more important as a lot of them used to recommend complete box sets to each other, often $100 +

[P]

Whoopee-do! You explained that well.

[suzysunshine7]

P wrote: "

A sad snail"

YAYYY!!! - YOU DID IT!!! - WELL DONE!!! ... ;o> ... ;o> ... ;o>

And what a stunningly handsome Snail you are too!

[P]

Hmm, all about getting the right pik link!

[Uglybug]

Hey Suzysunshine7 that was very well explained to P, but I have not a clue, Lol.
Anyone know how to post a pic using an iPad? Hmm?
I'm now going googling,
google, google, google,goo......

[suzysunshine7]

Lez wrote: "P wrote: “"I suspect our custom was just a drop in the ocean and won’t be noticed.

Sadly I think you might be right there, Lez Lee. I don't think a drop in a couple of hundred sales a week, if that, from the more regular Forum users who would also shop at the same time as they posted will make much of an impact or difference to such a huge site as Amazon?

I buy several things on Subscribe & Save at such bargain prices compared to anywhere elsewhere at the moment and so I had to go and check all of those out and to do some rescheduling on my Delivery dates. It felt very weird and rather lonely on there now what with not having a Forum page open as well to dip into.

[suzysunshine7]

Uglybug wrote: "Hey Suzysunshine7 that was very well explained to P, but I have not a clue, Lol.
Anyone know how to post a pic using an iPad? Hmm?
I'm now going googling,
google, google, google,goo......"

I will explain it to you via Email, Lovebug ... x x x ... and not the Goodreads Email - as I've discovered that you can also use it to post pictures on there as well when I was trying to explain how to do this to a friend the other day ;o>

[P]

Aaaaaargh!!!!

[suzysunshine7]

I just find a picture that I like on Google Images and use the Image Link Address provided or just pick an Image out on a Website like this one that I've just found on Amazon - and on Websites I place my Cursor over the Image, right-click on my Touch Pad to bring up a Menu Box, click on 'Copy' and then come back and 'Paste' it on here ...



And the page on Amazon where I found this particular Image is at ...

https://www.amazon.co.uk/JISEN-Newbor...

[suzysunshine7]

P wrote: "

Aaaaaargh!!!!"

ARRRGGGHHH!!! - Ohhh what have I started off on here?!! - LOL!!! ;o>

[Granny]

Crikey what a day! So many lovely snail pictures! My shell is red and gold with Storm Trooper decals (so I don't hit anything) and the Magic Kingdom castle on my flag. I have LLAP on my back and MTFBWY on the front.
Paul, you have a lovely manner and brightened that Irish granny's day. The only folks we have going door to door are religious fruitcakes, scouts, and sales people wanting in to clean the carpet and sell stuff. Yikes.

[Granny]

P wrote: "

Aaaaaargh!!!!"



😅😅😅😅😅

[suzysunshine7]

Granny wrote: "Crikey what a day! So many lovely snail pictures! My shell is red and gold with Storm Trooper decals (so I don't hit anything) and the Magic Kingdom castle on my flag. I have LLAP on my back and MT..."

The Magic Kingdom Castle as in the Disney one, Granny? ;o> ...



WoW?!! - I didn't realise that I was mixing with Royal Snails here on Goodreads! ;o>

[Granny]

suzysunshine7 wrote: "Granny wrote: "Crikey what a day! So many lovely snail pictures! My shell is red and gold with Storm Trooper decals (so I don't hit anything) and the Magic Kingdom castle on my flag. I have LLAP on..."

Not royal, just too many fandoms. I have to fit them in somehow. If I can squeeze the X-Files logo and a Tardis somewhere, I'd do that too. My Jeep has Star Trek, Star Wars, Doctor Who/Torchwood, Avengers, Harry Potter, and other decals on it.

[suzysunshine7]

Fascinating! ;o> ...



And you can see more of them at ...

https://www.google.co.uk/search?q=sli...

[suzysunshine7]

And there is also an Artist, Stefan Siverud, who calls himself a 'snailpimp' and has posted these up online ...

http://escapekit.ca/post/121595888239...

[Gordon]

Lez wrote: "The American Classical forum was probably more important as a lot of them used to recommend complete box sets to each other, often $100 +"

I just received a box set of Shostakovich jazz & ballet suites and film music. Would have cost £9.99 + postage from Amazon, so not much of a loss, I guess. I got it for £6.99 (including postage) from an eBay seller.

[P]

Here's a 'Patti' snail

[P]

A disoriented snail...

[P]

A day snail...




...and a night snail...

[P]

But most of all, a friendly snail...

[suzysunshine7]

Have you seen this one though, P? - it's an African Land Snail that actually looks like a Rabbit! ...

[Craig White]

think of the amount of salt you'd need! :)

[suzysunshine7]

Tech wrote: "think of the amount of salt you'd need! :)"

Are you planning on being banned from this Thread? ;o>

[Granny]

🐌🐌🐌🐌🐌 These are the best I can do. I still can't get the picture process to work for me. Such lovely snails! The snails here in Wisconsin tend to be smaller. The lakes and creeks freeze in winter so size is kept in check. I'm a fan of that because spider size is also kept down, except for the dock spiders. They're gigantic. (Shudders)

[Craig White]

certainly don't want asalted! :)

[suzysunshine7]

"except for the dock spiders. They're gigantic. (Shudders)"

I'm not going to Google them, Granny, as I'm not keen on Spiders! It has taken me most of life now to be able to get brave enough to get close enough to put a Glass over them then slide a bit of Cardboard underneath and bring myself to pick them up.

I can't bear to kill anything except for 'orrible Daddy Longlegs and they tend to fall apart anyway if you even try to put them outside - and so I release all of the Spiders that I catch in the House into our Garage rather than the Back Garden where they might possibly get eaten or catch 'cold' ;o>

[Craig White]

Dear SS7,
We feel we must inform you that your name has been added to our list for crimes against our species (known in Scotland as The Jenny Meggy), and from this day forward, WE WILL BE WATCHING YOU!
Much love,
The Daddy-Long Legs Liberation Sect.

[suzysunshine7]

Tech wrote: "Dear SS7,
We feel we must inform you that your name has been added to our list for crimes against our species (known in Scotland as The Jenny Meggy), and from this day forward, WE WILL BE WATCHING ..."

ARRRGGGHHH!!! - I promise to put any more Daddy Longlegs that try to dive-bomb me into a big box and post them all to tech in future! ;oO

[Craig White]

yum! :)

[suzysunshine7]

! ;oO

[P]

Woah, it's young Aragog!

[P]

suzysunshine7 wrote: "Have you seen this one though, P? - it's an African Land Snail that actually looks like a Rabbit! ..."

Yup, I saw that one but couldn't be certain if it was real or not!

[Granny]

P wrote: "

Woah, it's young Aragog!"

GGGGASCCCKKKKKRRRGHHEEEWWWWWWWPPPHHHHHTTTFFFGGGHHAAACCCCCVKKKKK

[suzysunshine7]

Granny wrote: "GGGGASCCCKKKKKRRRGHHEEEWWWWWWWPPPHHHHHTTTFFFGGGHHAAACCCCCVKKKKK"

Yep! - You can take that and double it from me too!!! ;oO

All of the years that it's taken me to finally manage to overcome my absolute terror of Spiders enough to be able to remove them from the Room all by myself and then the pesky P just had to go and post those pics up! ;oO

AAAAAAAAAAAAAARRRRRRRRRRRRRRGGGGGGGGGGGGGGHHHHHHHHHHHHHH!!!

[Granny]

suzysunshine7 wrote: "Granny wrote: "GGGGASCCCKKKKKRRRGHHEEEWWWWWWWPPPHHHHHTTTFFFGGGHHAAACCCCCVKKKKK"

Yep! - You can take that and double it from me too!!! ;oO

All of the years that it's taken me to finally manage to ..."

Suzy, you're nicer than I. Any 8-legs in my house is immediately, tried, sentenced, and executed. You're also wise to not look up dock spiders. Wisconsin even has a minor league baseball team with it as the mascot. Fond du Lac Dock Spiders. I can't go.

[Martin]

Unfortunately not P, according to latest on business news, Amazon's profits are soaring higher than ever, share prices are up significantly. There's no justice!